Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
Protein automated matches [226903] (39 species) not a true protein |
Species Haemophilus influenzae [TaxId:71421] [268351] (10 PDB entries) |
Domain d6ojha1: 6ojh A:1-114 [380433] Other proteins in same PDB: d6ojha2, d6ojha3 automated match to d3rv3a1 complexed with act, ca, mv4 |
PDB Entry: 6ojh (more details), 2.05 Å
SCOPe Domain Sequences for d6ojha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ojha1 c.30.1.0 (A:1-114) automated matches {Haemophilus influenzae [TaxId: 71421]} mlekvvianrgeialrilrackelgiktvavhstadrdlkhvlladeticigpapsaksy lnipaiiaaaevtgadaihpgygflsenadfaeqversgftfigptadvirlmg
Timeline for d6ojha1: