Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.7: DNA-binding domain of retroviral integrase [50122] (2 families) |
Family b.34.7.1: DNA-binding domain of retroviral integrase [50123] (2 proteins) |
Protein automated matches [347599] (2 species) not a true protein |
Species Simian immunodeficiency virus [TaxId:11723] [380156] (3 PDB entries) |
Domain d6rwol2: 6rwo L:223-272 [380235] Other proteins in same PDB: d6rwoc1, d6rwoc2, d6rwod1, d6rwoe1, d6rwoe2, d6rwok1, d6rwok2, d6rwol1, d6rwom1, d6rwom2 automated match to d1ex4a1 protein/DNA complex; complexed with cl, klq, mg, zn |
PDB Entry: 6rwo (more details), 3.05 Å
SCOPe Domain Sequences for d6rwol2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rwol2 b.34.7.1 (L:223-272) automated matches {Simian immunodeficiency virus [TaxId: 11723]} frvyfregrdqqwkgpatliwkgegavviqdgqdlkvvprrkckiikdyg
Timeline for d6rwol2: