SCOPe 2.07: Domain d6rwol1: 6rwo L:57-222

Lineage for d6rwol1 (6rwo L:57-222)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Simian immunodeficiency virus [TaxId:11723] [380162] (3 PDB entries)

8. Domain d6rwol1: 6rwo L:57-222 [380234]
   Other proteins in same PDB: d6rwoc1, d6rwod2, d6rwoe1, d6rwoe2, d6rwof1, d6rwok1, d6rwol2, d6rwom1, d6rwom2, d6rwon1
   automated match to d1ex4b2
   protein/DNA complex; complexed with cl, klq, mg, zn

Details for d6rwol1

PDB Entry: 6rwo, 3.05 Å

PDB Description: sivrcm intasome (q148h/g140s) in complex with bictegravir

PDB Compounds: (L:) pol protein

SCOPe Domain Sequences for d6rwol1:

Sequence, based on SEQRES records:

>d6rwol1 c.55.3.0 (L:57-222) automated matches {Simian immunodeficiency virus [TaxId: 11723]}
spktwqmdcthlegkviivavhvasgyieaevlpaetgketahfllklaarwpvkhlhtd
ngdnftssavqavcwwaqiehtfsvpynpqshgvvesmnhqlktiitqirdqaekietav
qmavlihnfkrkggiggysageriidiiasdlqttklqnqiskiqn

Sequence, based on observed residues (ATOM records):

>d6rwol1 c.55.3.0 (L:57-222) automated matches {Simian immunodeficiency virus [TaxId: 11723]}
spktwqmdcthlegkviivavhvasgyieaevlpaetgketahfllklaarwpvkhlhtd
ngdnftssavqavcwwaqiehtfsvvesmnhqlktiitqirdqaekietavqmavlihnf
krkggiggysageriidiiasdlqttklqnqiskiqn

Timeline for d6rwol1:

• d6rwol1 is new in SCOPe 2.07-stable
  
• d6rwol1 appears in the current release, SCOPe 2.08