Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.10: N-terminal Zn binding domain of HIV integrase [46919] (2 families) |
Family a.4.10.0: automated matches [380158] (1 protein) not a true family |
Protein automated matches [380159] (1 species) not a true protein |
Species Simian immunodeficiency virus [TaxId:11723] [380160] (3 PDB entries) |
Domain d6rwmc1: 6rwm C:4-43 [380225] Other proteins in same PDB: d6rwmc2, d6rwmd1, d6rwmd2, d6rwme2, d6rwmf1, d6rwmk2, d6rwml1, d6rwml2, d6rwmm2, d6rwmn1 automated match to d1k6ya1 protein/DNA complex; complexed with cl, klq, mg, zn |
PDB Entry: 6rwm (more details), 2.81 Å
SCOPe Domain Sequences for d6rwmc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rwmc1 a.4.10.0 (C:4-43) automated matches {Simian immunodeficiency virus [TaxId: 11723]} giekaqeehekyhnnwramaedfqipqvvakeivaqcpkc
Timeline for d6rwmc1: