Lineage for d6rwmc1 (6rwm C:4-43)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2309001Superfamily a.4.10: N-terminal Zn binding domain of HIV integrase [46919] (2 families) (S)
  5. 2309029Family a.4.10.0: automated matches [380158] (1 protein)
    not a true family
  6. 2309030Protein automated matches [380159] (1 species)
    not a true protein
  7. 2309031Species Simian immunodeficiency virus [TaxId:11723] [380160] (3 PDB entries)
  8. 2309032Domain d6rwmc1: 6rwm C:4-43 [380225]
    Other proteins in same PDB: d6rwmc2, d6rwmd1, d6rwmd2, d6rwme2, d6rwmf1, d6rwmk2, d6rwml1, d6rwml2, d6rwmm2, d6rwmn1
    automated match to d1k6ya1
    protein/DNA complex; complexed with cl, klq, mg, zn

Details for d6rwmc1

PDB Entry: 6rwm (more details), 2.81 Å

PDB Description: sivrcm intasome in complex with bictegravir
PDB Compounds: (C:) pol protein

SCOPe Domain Sequences for d6rwmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rwmc1 a.4.10.0 (C:4-43) automated matches {Simian immunodeficiency virus [TaxId: 11723]}
giekaqeehekyhnnwramaedfqipqvvakeivaqcpkc

SCOPe Domain Coordinates for d6rwmc1:

Click to download the PDB-style file with coordinates for d6rwmc1.
(The format of our PDB-style files is described here.)

Timeline for d6rwmc1: