Lineage for d6rwnd2 (6rwn D:223-272)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394036Superfamily b.34.7: DNA-binding domain of retroviral integrase [50122] (2 families) (S)
  5. 2394037Family b.34.7.1: DNA-binding domain of retroviral integrase [50123] (2 proteins)
  6. 2394057Protein automated matches [347599] (2 species)
    not a true protein
  7. 2394066Species Simian immunodeficiency virus [TaxId:11723] [380156] (3 PDB entries)
  8. 2394075Domain d6rwnd2: 6rwn D:223-272 [380197]
    Other proteins in same PDB: d6rwnc1, d6rwnc2, d6rwnd1, d6rwne1, d6rwne2, d6rwnk1, d6rwnk2, d6rwnl1, d6rwnm1, d6rwnm2
    automated match to d1ex4a1
    protein/DNA complex; complexed with cl, dlu, mg, zn

Details for d6rwnd2

PDB Entry: 6rwn (more details), 3.1 Å

PDB Description: sivrcm intasome in complex with dolutegravir
PDB Compounds: (D:) pol protein

SCOPe Domain Sequences for d6rwnd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rwnd2 b.34.7.1 (D:223-272) automated matches {Simian immunodeficiency virus [TaxId: 11723]}
frvyfregrdqqwkgpatliwkgegavviqdgqdlkvvprrkckiikdyg

SCOPe Domain Coordinates for d6rwnd2:

Click to download the PDB-style file with coordinates for d6rwnd2.
(The format of our PDB-style files is described here.)

Timeline for d6rwnd2: