SCOPe 2.07: Domain d6rwnd1: 6rwn D:57-222

Lineage for d6rwnd1 (6rwn D:57-222)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)

6. Protein Retroviral integrase, catalytic domain [53108] (4 species)

7. Species Simian immunodeficiency virus [TaxId:11723] [53111] (3 PDB entries)

8. Domain d6rwnd1: 6rwn D:57-222 [380196]
   Other proteins in same PDB: d6rwnc1, d6rwnc2, d6rwnd2, d6rwne1, d6rwne2, d6rwnf1, d6rwnk1, d6rwnk2, d6rwnl2, d6rwnm1, d6rwnm2, d6rwnn1
   automated match to d1ex4b2
   protein/DNA complex; complexed with cl, dlu, mg, zn

Details for d6rwnd1

PDB Entry: 6rwn, 3.1 Å

PDB Description: sivrcm intasome in complex with dolutegravir

PDB Compounds: (D:) pol protein

SCOPe Domain Sequences for d6rwnd1:

Sequence, based on SEQRES records:

>d6rwnd1 c.55.3.2 (D:57-222) Retroviral integrase, catalytic domain {Simian immunodeficiency virus [TaxId: 11723]}
spktwqmdcthlegkviivavhvasgyieaevlpaetgketahfllklaarwpvkhlhtd
ngdnftssavqavcwwaqiehtfgvpynpqsqgvvesmnhqlktiitqirdqaekietav
qmavlihnfkrkggiggysageriidiiasdlqttklqnqiskiqn

Sequence, based on observed residues (ATOM records):

>d6rwnd1 c.55.3.2 (D:57-222) Retroviral integrase, catalytic domain {Simian immunodeficiency virus [TaxId: 11723]}
spktwqmdcthlegkviivavhvasgyieaevlpaetgketahfllklaarwpvkhlhtd
ngdnftssavqavcwwaqiehtfgvvesmnhqlktiitqirdqaekietavqmavlihnf
krkggiggysageriidiiasdlqttklqnqiskiqn

Timeline for d6rwnd1:

• d6rwnd1 is new in SCOPe 2.07-stable
  
• d6rwnd1 appears in the current release, SCOPe 2.08