SCOPe 2.08: Domain d6saia1: 6sai A:1-91

Lineage for d6saia1 (6sai A:1-91)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.0: automated matches [191629] (1 protein)
   not a true family

6. Protein automated matches [191156] (12 species)
   not a true protein

7. Species Human endogenous retrovirus k [TaxId:45617] [379094] (1 PDB entry)

8. Domain d6saia1: 6sai A:1-91 [379095]
   Other proteins in same PDB: d6saia2, d6saib2
   automated match to d5teob_

Details for d6saia1

PDB Entry: 6sai

PDB Description: nmr solution structure of hml-2 c-terminal dimer domain

PDB Compounds: (A:) gag protein

SCOPe Domain Sequences for d6saia1:

Sequence; same for both SEQRES and ATOM records:

>d6saia1 a.28.3.0 (A:1-91) automated matches {Human endogenous retrovirus k [TaxId: 45617]}
psfntvrqgskepypdfvarlqdvaqksiadekarkvivelmayenanpecqsaikplkg
kvpagsdviseyvkacdgiggamhkamlmaq

Timeline for d6saia1:

• d6saia1 first appeared in SCOPe 2.07