Lineage for d6nmna2 (6nmn A:126-253)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312794Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2313855Superfamily a.24.16: Nucleotidyltransferase substrate binding subunit/domain [81593] (5 families) (S)
  5. 2313856Family a.24.16.1: Kanamycin nucleotidyltransferase (KNTase), C-terminal domain [81592] (2 proteins)
    N-terminal catalytic domain is followed by an all-alpha domain
    automatically mapped to Pfam PF07827
  6. 2313863Protein automated matches [379001] (3 species)
    not a true protein
  7. 2313873Species Geobacillus stearothermophilus [TaxId:1422] [379002] (4 PDB entries)
  8. 2313874Domain d6nmna2: 6nmn A:126-253 [379022]
    Other proteins in same PDB: d6nmna1, d6nmnb1
    automated match to d1kana1
    protein/DNA complex; complexed with a, mg, nmy; mutant

Details for d6nmna2

PDB Entry: 6nmn (more details), 1.8 Å

PDB Description: ternary complex structure of the t130k mutant of ant-4'' with neomycin and atp (no pyrophosphate)
PDB Compounds: (A:) kanamycin nucleotidyltransferase

SCOPe Domain Sequences for d6nmna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nmna2 a.24.16.1 (A:126-253) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
veaqkfhdaicaliveelfeyagkwrnirvqgpttflpsltvqvamagamliglhhricy
ttsasvlteavkqsdlpsgydhlcqfvmsgqlsdseklleslenfwngiqewterhgyiv
dvskripf

SCOPe Domain Coordinates for d6nmna2:

Click to download the PDB-style file with coordinates for d6nmna2.
(The format of our PDB-style files is described here.)

Timeline for d6nmna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6nmna1