Class a: All alpha proteins [46456] (289 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.16: Nucleotidyltransferase substrate binding subunit/domain [81593] (5 families) |
Family a.24.16.1: Kanamycin nucleotidyltransferase (KNTase), C-terminal domain [81592] (2 proteins) N-terminal catalytic domain is followed by an all-alpha domain automatically mapped to Pfam PF07827 |
Protein automated matches [379001] (3 species) not a true protein |
Species Geobacillus stearothermophilus [TaxId:1422] [379002] (4 PDB entries) |
Domain d6nmna2: 6nmn A:126-253 [379022] Other proteins in same PDB: d6nmna1, d6nmnb1 automated match to d1kana1 protein/DNA complex; complexed with a, mg, nmy; mutant |
PDB Entry: 6nmn (more details), 1.8 Å
SCOPe Domain Sequences for d6nmna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nmna2 a.24.16.1 (A:126-253) automated matches {Geobacillus stearothermophilus [TaxId: 1422]} veaqkfhdaicaliveelfeyagkwrnirvqgpttflpsltvqvamagamliglhhricy ttsasvlteavkqsdlpsgydhlcqfvmsgqlsdseklleslenfwngiqewterhgyiv dvskripf
Timeline for d6nmna2: