Lineage for d1f52d1 (1f52 D:1-100)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2180100Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) (S)
    automatically mapped to Pfam PF03951
  5. 2180101Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)
  6. 2180102Protein Glutamine synthetase, N-terminal domain [54370] (2 species)
  7. 2180152Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries)
  8. 2180156Domain d1f52d1: 1f52 D:1-100 [37842]
    Other proteins in same PDB: d1f52a2, d1f52b2, d1f52c2, d1f52d2, d1f52e2, d1f52f2, d1f52g2, d1f52h2, d1f52i2, d1f52j2, d1f52k2, d1f52l2
    complexed with adp, mn, mpd

Details for d1f52d1

PDB Entry: 1f52 (more details), 2.49 Å

PDB Description: crystal structure of glutamine synthetase from salmonella typhimurium co-crystallized with adp
PDB Compounds: (D:) glutamine synthetase

SCOPe Domain Sequences for d1f52d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f52d1 d.15.9.1 (D:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
nesdmvlmpdastavidpffadstliircdilepgtlqgy

SCOPe Domain Coordinates for d1f52d1:

Click to download the PDB-style file with coordinates for d1f52d1.
(The format of our PDB-style files is described here.)

Timeline for d1f52d1: