SCOPe 2.07: Domain d6nega2: 6neg A:104-351

Lineage for d6nega2 (6neg A:104-351)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (81 species)
   not a true protein

7. Species Thalictrum flavum [TaxId:150095] [318181] (8 PDB entries)

8. Domain d6nega2: 6neg A:104-351 [378297]
   Other proteins in same PDB: d6nega1, d6negb1
   automated match to d1kyzc2
   complexed with sah; mutant

Details for d6nega2

PDB Entry: 6neg, 1.95 Å

PDB Description: n191d, f205s mutant of scoulerine-9-o methyltransferase from thalictrum flavum complexed with s-adenosyl-l-homocysteine

PDB Compounds: (A:) (S)-scoulerine 9-O-methyltransferase

SCOPe Domain Sequences for d6nega2:

Sequence; same for both SEQRES and ATOM records:

>d6nega2 c.66.1.0 (A:104-351) automated matches {Thalictrum flavum [TaxId: 150095]}
ngvsvvpmllftsdkavvesfynikdvvleegvipfdrthgmdffayagkeqsvnksfnq
amgagstiafdevfkvykgfhdlkelvdvgggigtslsniiskyphikginfelphviad
apnypgvehiagnmfegvpnaqnillkwvlhdwddersikilqncwkalpeggtvivvef
vlpqilgnnaesfnaltpdllmmtlnpggkertttefdglakaagfaetkffpisqglhv
mefhkata

Timeline for d6nega2:

• d6nega2 is new in SCOPe 2.07-stable
  
• d6nega2 appears in the current release, SCOPe 2.08