Lineage for d1pgb__ (1pgb -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77788Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 78181Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 78182Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)
  6. 78192Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species)
  7. 78193Species Streptococcus sp., group G [TaxId:1306] [54361] (16 PDB entries)
  8. 78197Domain d1pgb__: 1pgb - [37824]

Details for d1pgb__

PDB Entry: 1pgb (more details), 1.92 Å

PDB Description: two crystal structures of the b1 immunoglobulin-binding domain of streptoccocal protein g and comparison with nmr

SCOP Domain Sequences for d1pgb__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pgb__ d.15.7.1 (-) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G}
mtyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte

SCOP Domain Coordinates for d1pgb__:

Click to download the PDB-style file with coordinates for d1pgb__.
(The format of our PDB-style files is described here.)

Timeline for d1pgb__: