SCOPe 2.02: Domain d1igda_: 1igd A:

Lineage for d1igda_ (1igd A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)

6. Protein Immunoglobulin-binding protein G, different constituent domains [54360] (3 species)

7. Species Streptococcus sp., group G [TaxId:1306] [54361] (31 PDB entries)

8. Domain d1igda_: 1igd A: [37822]

Details for d1igda_

PDB Entry: 1igd, 1.1 Å

PDB Description: the third igg-binding domain from streptococcal protein g: an analysis by x-ray crystallography of the structure alone and in a complex with fab

PDB Compounds: (A:) protein g

SCOPe Domain Sequences for d1igda_:

Sequence; same for both SEQRES and ATOM records:

>d1igda_ d.15.7.1 (A:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
mtpavttyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftvt
e

Timeline for d1igda_:

• d1igda_ first appeared (with stable ids) in SCOP 1.55, called d1igd__
  
• d1igda_ appears in SCOPe 2.01
  
• d1igda_ appears in SCOPe 2.03
  
• d1igda_ appears in the current release, SCOPe 2.08