Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families) alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices |
Family d.110.7.0: automated matches [375374] (1 protein) not a true family |
Protein automated matches [375375] (2 species) not a true protein |
Species Myxococcus xanthus [TaxId:34] [377225] (2 PDB entries) |
Domain d6hjmn_: 6hjm N: [377677] automated match to d1j3wb_ |
PDB Entry: 6hjm (more details), 2.39 Å
SCOPe Domain Sequences for d6hjmn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hjmn_ d.110.7.0 (N:) automated matches {Myxococcus xanthus [TaxId: 34]} eeftkinavcdrltkdanakvvflvdkngqlissagqtqnidttslasltagnvaamggl akligenefpnqfhegakdslymtivgsrvvlvvifdnrtslglvrlrikkasdeltkif esl
Timeline for d6hjmn_: