Lineage for d6hjms_ (6hjm S:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2577625Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. 2577701Family d.110.7.0: automated matches [375374] (1 protein)
    not a true family
  6. 2577702Protein automated matches [375375] (2 species)
    not a true protein
  7. 2577705Species Myxococcus xanthus [TaxId:34] [377225] (2 PDB entries)
  8. 2577724Domain d6hjms_: 6hjm S: [377675]
    automated match to d1j3wb_

Details for d6hjms_

PDB Entry: 6hjm (more details), 2.39 Å

PDB Description: myxococcus xanthus mglb
PDB Compounds: (S:) MglB

SCOPe Domain Sequences for d6hjms_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hjms_ d.110.7.0 (S:) automated matches {Myxococcus xanthus [TaxId: 34]}
lvmyeeeftkinavcdrltkdanakvvflvdkngqlissagqtqnidttslasltagnva
amgglakligenefpnqfhegakdslymtivgsrvvlvvifdnrtslglvrlrikkasde
ltkifes

SCOPe Domain Coordinates for d6hjms_:

Click to download the PDB-style file with coordinates for d6hjms_.
(The format of our PDB-style files is described here.)

Timeline for d6hjms_: