SCOP 1.59: Domain d1ts3a2: 1ts3 A:94-194

Lineage for d1ts3a2 (1ts3 A:94-194)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins)

6. Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54341] (11 PDB entries)

8. Domain d1ts3a2: 1ts3 A:94-194 [37757]
   Other proteins in same PDB: d1ts3a1, d1ts3b1, d1ts3c1

Details for d1ts3a2

PDB Entry: 1ts3, 2 Å

PDB Description: h135a mutant of toxic shock syndrome toxin-1 from s. aureus

SCOP Domain Sequences for d1ts3a2:

Sequence; same for both SEQRES and ATOM records:

>d1ts3a2 d.15.6.1 (A:94-194) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus}
lptpielplkvkvhgkdsplkywpkfdkkqlaistldfeiraqltqihglyrssdktggy
wkitmndgstyqsdlskkfeyntekppinideiktieaein

Timeline for d1ts3a2:

• d1ts3a2 first appeared (with stable ids) in SCOP 1.55
  
• d1ts3a2 appears in SCOP 1.57
  
• d1ts3a2 appears in SCOP 1.61
  
• d1ts3a2 appears in the current release, SCOPe 2.08