Lineage for d1esfa2 (1esf A:121-233)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30383Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 30633Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 30634Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins)
  6. 30635Protein Staphylococcal enterotoxin A, SEA [54336] (1 species)
  7. 30636Species Staphylococcus aureus [TaxId:1280] [54337] (4 PDB entries)
  8. 30637Domain d1esfa2: 1esf A:121-233 [37735]
    Other proteins in same PDB: d1esfa1, d1esfb1

Details for d1esfa2

PDB Entry: 1esf (more details), 1.9 Å

PDB Description: staphylococcal enterotoxin a

SCOP Domain Sequences for d1esfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1esfa2 d.15.6.1 (A:121-233) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus}
eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
rglivfhtstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts

SCOP Domain Coordinates for d1esfa2:

Click to download the PDB-style file with coordinates for d1esfa2.
(The format of our PDB-style files is described here.)

Timeline for d1esfa2:

Domains from same chain:
(mouse over for more information)
d1esfa1
Domains from other chains:
(mouse over for more information)
d1esfb1, d1esfb2