Lineage for d1esfa2 (1esf A:121-233)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. Protein Staphylococcal enterotoxin A, SEA [54336] (1 species)
  7. Species Staphylococcus aureus [TaxId:1280] [54337] (7 PDB entries)
  8. Domain d1esfa2: 1esf A:121-233 [37735]
    Other proteins in same PDB: d1esfa1, d1esfb1
    complexed with cd

Details for d1esfa2

PDB Entry: 1esf (more details), 1.9 Å

PDB Description: staphylococcal enterotoxin a
PDB Compounds: (A:) staphylococcal enterotoxin a

SCOPe Domain Sequences for d1esfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1esfa2 d.15.6.1 (A:121-233) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus [TaxId: 1280]}
eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
rglivfhtstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts

SCOPe Domain Coordinates for d1esfa2 are not available.

Timeline for d1esfa2:

Domains from same chain:
(mouse over for more information)
d1esfa1
Domains from other chains:
(mouse over for more information)
d1esfb1, d1esfb2