SCOPe 2.07: Domain d6i72a1: 6i72 A:14-119

Lineage for d6i72a1 (6i72 A:14-119)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (87 species)
   not a true protein

7. Species Fragaria ananassa [TaxId:3747] [377209] (5 PDB entries)

8. Domain d6i72a1: 6i72 A:14-119 [377329]
   Other proteins in same PDB: d6i72a2, d6i72b2
   automated match to d1kyze1
   complexed with dhc, edo, sah, so4

Details for d6i72a1

PDB Entry: 6i72, 1.5 Å

PDB Description: structure of fragaria ananassa o-methyltransferase in complex with s- adenosylhomocysteine and caffeic acid

PDB Compounds: (A:) O-methyltransferase

SCOPe Domain Sequences for d6i72a1:

Sequence; same for both SEQRES and ATOM records:

>d6i72a1 a.4.5.0 (A:14-119) automated matches {Fragaria ananassa [TaxId: 3747]}
vsdeeanlfamqlasasvlpmvlkaaieldlleimakagpgsflspsdlasqlptknpea
pvmldrmlrllasysiltcslrtlpdgkverlyclgpvckfltkne

Timeline for d6i72a1:

• d6i72a1 is new in SCOPe 2.07-stable
  
• d6i72a1 appears in the current release, SCOPe 2.08