SCOPe 2.07: Domain d6i72b2: 6i72 B:120-365

Lineage for d6i72b2 (6i72 B:120-365)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (6 proteins)
   automatically mapped to Pfam PF00891

6. Protein automated matches [226979] (4 species)
   not a true protein

7. Species Fragaria ananassa [TaxId:3747] [377223] (5 PDB entries)

8. Domain d6i72b2: 6i72 B:120-365 [377296]
   Other proteins in same PDB: d6i72a1, d6i72b1
   automated match to d1kyzc2
   complexed with dhc, edo, sah, so4

Details for d6i72b2

PDB Entry: 6i72, 1.5 Å

PDB Description: structure of fragaria ananassa o-methyltransferase in complex with s- adenosylhomocysteine and caffeic acid

PDB Compounds: (B:) O-methyltransferase

SCOPe Domain Sequences for d6i72b2:

Sequence; same for both SEQRES and ATOM records:

>d6i72b2 c.66.1.12 (B:120-365) automated matches {Fragaria ananassa [TaxId: 3747]}
dgvsiaalclmnqdkvlveswyhlkdavldggipfnkaygmtafdyhgtdprfnkvfnkg
madhstitmkkiletykgfeglksivdvgggtgavvnmivskypsikginfdlphvieda
pqypgvqhvggdmfvsvpkgnaifmkwichdwsdehcikflkncyaalpddgkvilaeci
lpvapdtslatkgvvhmdvimlahnpggkerteqefealakgsgfqgirvccdafntyvi
eflkki

Timeline for d6i72b2:

• d6i72b2 is new in SCOPe 2.07-stable
  
• d6i72b2 appears in the current release, SCOPe 2.08