Lineage for d1qlbb2 (1qlb B:1-106)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1018449Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1018592Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (13 proteins)
  6. 1018635Protein Fumarate reductase iron-sulfur protein, N-terminal domain [54325] (2 species)
  7. 1018647Species Wolinella succinogenes [TaxId:844] [54327] (5 PDB entries)
  8. 1018652Domain d1qlbb2: 1qlb B:1-106 [37709]
    Other proteins in same PDB: d1qlba1, d1qlba2, d1qlba3, d1qlbb1, d1qlbc_, d1qlbd1, d1qlbd2, d1qlbd3, d1qlbe1, d1qlbf_
    complexed with ca, f3s, fad, fes, fmr, hem, lmt, sf4

Details for d1qlbb2

PDB Entry: 1qlb (more details), 2.33 Å

PDB Description: respiratory complex II-like fumarate reductase from Wolinella succinogenes
PDB Compounds: (B:) fumarate reductase iron-sulfur protein

SCOPe Domain Sequences for d1qlbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlbb2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]}
mgrmltirvfkydpqsavskphfqeykieeapsmtifivlnmiretydpdlnfdfvcrag
icgscgmmingrpslacrtltkdfedgvitllplpafklikdlsvd

SCOPe Domain Coordinates for d1qlbb2:

Click to download the PDB-style file with coordinates for d1qlbb2.
(The format of our PDB-style files is described here.)

Timeline for d1qlbb2: