Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
Protein automated matches [190149] (15 species) not a true protein |
Species Neisseria meningitidis [TaxId:487] [376758] (5 PDB entries) |
Domain d6naqm_: 6naq M: [376945] automated match to d5g1sl_ complexed with k |
PDB Entry: 6naq (more details), 2.02 Å
SCOPe Domain Sequences for d6naqm_:
Sequence, based on SEQRES records: (download)
>d6naqm_ c.14.1.1 (M:) automated matches {Neisseria meningitidis [TaxId: 487]} ptvieqsgrgerafdiysrllkerivflvgpvtdesanlvvaqllflesenpdkdiffyi nspggsvtagmsiydtmnfikpdvstlclgqaasmgafllsagekgkrfalpnsrimihq plisgglggqasdieiharellkikeklnrlmakhcdrdladlerdtdrdnfmsaeeake yglidqilenras
>d6naqm_ c.14.1.1 (M:) automated matches {Neisseria meningitidis [TaxId: 487]} ptvfdiysrllkerivflvgpvtdesanlvvaqllflesenpdkdiffyinspggsvtag msiydtmnfikpdvstlclgqaasmgafllsagekgkrfalpnsrimihqplisgglggq asdieiharellkikeklnrlmakhcdrdladlerdtdrdnfmsaeeakeyglidqilen ras
Timeline for d6naqm_: