Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
Protein automated matches [190149] (15 species) not a true protein |
Species Escherichia coli [TaxId:83333] [376807] (5 PDB entries) |
Domain d6nb1m_: 6nb1 M: [376886] automated match to d1yg6a_ complexed with gol, khs |
PDB Entry: 6nb1 (more details), 1.9 Å
SCOPe Domain Sequences for d6nb1m_:
Sequence, based on SEQRES records: (download)
>d6nb1m_ c.14.1.1 (M:) automated matches {Escherichia coli [TaxId: 83333]} vpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiyly inspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmih qplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeavey glvdsilthrn
>d6nb1m_ c.14.1.1 (M:) automated matches {Escherichia coli [TaxId: 83333]} vpmfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitag msiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqat dieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn
Timeline for d6nb1m_: