Lineage for d6naye_ (6nay E:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2460578Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2460794Protein automated matches [190149] (15 species)
    not a true protein
  7. 2461073Species Neisseria meningitidis [TaxId:487] [376758] (5 PDB entries)
  8. 2461099Domain d6naye_: 6nay E: [376787]
    automated match to d5g1sl_
    mutant

Details for d6naye_

PDB Entry: 6nay (more details), 2.2 Å

PDB Description: crystal structure of neisseria meningitidis clpp protease e31a+e58a activated double mutant
PDB Compounds: (E:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d6naye_:

Sequence, based on SEQRES records: (download)

>d6naye_ c.14.1.1 (E:) automated matches {Neisseria meningitidis [TaxId: 487]}
diysrllkarivflvgpvtdesanlvvaqllflesanpdkdiffyinspggsvtagmsiy
dtmnfikpdvstlclgqaasmgafllsagekgkrfalpnsrimihqplisgglggqasdi
eiharellkikeklnrlmakhcdrdladlerdtdrdnfmsaeeakeyglidqilenr

Sequence, based on observed residues (ATOM records): (download)

>d6naye_ c.14.1.1 (E:) automated matches {Neisseria meningitidis [TaxId: 487]}
diysrllkarivflvgpvtdesanlvvaqllflesanpdkdiffyinspggsvtagmsiy
dtmnfikpdvstlclgqaasmgafllsagekgkrfalpnsrimihqpliggqasdieiha
rellkikeklnrlmakhcdrdladlerdtdrdnfmsaeeakeyglidqilenr

SCOPe Domain Coordinates for d6naye_:

Click to download the PDB-style file with coordinates for d6naye_.
(The format of our PDB-style files is described here.)

Timeline for d6naye_: