SCOPe 2.07: Domain d6kg2a1: 6kg2 A:36-156

Lineage for d6kg2a1 (6kg2 A:36-156)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (38 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225016] (9 PDB entries)

8. Domain d6kg2a1: 6kg2 A:36-156 [376700]
   Other proteins in same PDB: d6kg2a2, d6kg2b2
   automated match to d5tc4a1
   complexed with d8c, nad, po4

Details for d6kg2a1

PDB Entry: 6kg2, 2.25 Å

PDB Description: human mthfd2 in complex with compound 18

PDB Compounds: (A:) Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial

SCOPe Domain Sequences for d6kg2a1:

Sequence; same for both SEQRES and ATOM records:

>d6kg2a1 c.58.1.0 (A:36-156) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eavvisgrklaqqikqevrqeveewvasgnkrphlsvilvgenpashsyvlnktraaavv
ginsetimkpasiseeellnlinklnnddnvdgllvqlplpehiderricnavspdkdvd
g

Timeline for d6kg2a1:

• d6kg2a1 is new in SCOPe 2.07-stable
  
• d6kg2a1 appears in the current release, SCOPe 2.08