Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186944] (62 PDB entries) |
Domain d6kg2b2: 6kg2 B:157-332 [376699] Other proteins in same PDB: d6kg2a1, d6kg2b1 automated match to d5tc4a2 complexed with d8c, nad, po4 |
PDB Entry: 6kg2 (more details), 2.25 Å
SCOPe Domain Sequences for d6kg2b2:
Sequence, based on SEQRES records: (download)
>d6kg2b2 c.2.1.0 (B:157-332) automated matches {Human (Homo sapiens) [TaxId: 9606]} fhvinvgrmcldqysmlpatpwgvweiikrtgiptlgknvvvagrsknvgmpiamllhtd gaherpggdatvtishrytpkeqlkkhtiladivisaagipnlitadmikegaavidvgi nrvhdpvtakpklvgdvdfegvrqkagyitpvpggvgpmtvamlmkntiiaakkvl
>d6kg2b2 c.2.1.0 (B:157-332) automated matches {Human (Homo sapiens) [TaxId: 9606]} fhvinvgrmcldqysmlpatpwgvweiikrtgiptlgknvvvagrsknvgmpiamllhtd gaherpggdatvtishrytpkeqlkkhtiladivisaagipnlitadmikegaavidvgi nrvpklvgdvdfegvrqkagyitpvpggvgpmtvamlmkntiiaakkvl
Timeline for d6kg2b2: