Lineage for d1fxib_ (1fxi B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1018449Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1018450Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 1018451Protein 2Fe-2S ferredoxin [54294] (17 species)
  7. 1018471Species Aphanothece sacrum [TaxId:1122] [54297] (1 PDB entry)
  8. 1018473Domain d1fxib_: 1fxi B: [37665]
    complexed with fes

Details for d1fxib_

PDB Entry: 1fxi (more details), 2.2 Å

PDB Description: structure of the [2fe-2s] ferredoxin i from the blue-green alga aphanothece sacrum at 2.2 angstroms resolution
PDB Compounds: (B:) ferredoxin I

SCOPe Domain Sequences for d1fxib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fxib_ d.15.4.1 (B:) 2Fe-2S ferredoxin {Aphanothece sacrum [TaxId: 1122]}
asykvtlktpdgdnvitvpddeyildvaeeegldlpyscragacstcagklvsgpapded
qsfldddqiqagyiltcvayptgdcviethkeealy

SCOPe Domain Coordinates for d1fxib_:

Click to download the PDB-style file with coordinates for d1fxib_.
(The format of our PDB-style files is described here.)

Timeline for d1fxib_: