SCOPe 2.06: Domain d1fxab_: 1fxa B:

Lineage for d1fxab_ (1fxa B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)

6. Protein 2Fe-2S ferredoxin [54294] (19 species)

7. Species Anabaena sp., pcc 7119 and 7120 [TaxId:1167] [54295] (12 PDB entries)

8. Domain d1fxab_: 1fxa B: [37661]
   complexed with fes

Details for d1fxab_

PDB Entry: 1fxa, 2.5 Å

PDB Description: crystallization and structure determination to 2.5-angstroms resolution of the oxidized [2fe-2s] ferredoxin isolated from anabaena 7120

PDB Compounds: (B:) [2Fe-2S] ferredoxin

SCOPe Domain Sequences for d1fxab_:

Sequence; same for both SEQRES and ATOM records:

>d1fxab_ d.15.4.1 (B:) 2Fe-2S ferredoxin {Anabaena sp., pcc 7119 and 7120 [TaxId: 1167]}
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
sdqsfldddqieagyvltcvayptsdvviqthkeedly

Timeline for d1fxab_:

• d1fxab_ first appeared (with stable ids) in SCOP 1.55
  
• d1fxab_ appears in SCOPe 2.05
  
• d1fxab_ appears in SCOPe 2.07
  
• d1fxab_ appears in the current release, SCOPe 2.08