Lineage for d1qoga_ (1qog A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1195552Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1195553Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 1195554Protein 2Fe-2S ferredoxin [54294] (17 species)
  7. 1195555Species Anabaena sp., pcc 7119 and 7120 [TaxId:1167] [54295] (12 PDB entries)
  8. 1195568Domain d1qoga_: 1qog A: [37657]
    complexed with fes, so4; mutant

Details for d1qoga_

PDB Entry: 1qog (more details), 1.8 Å

PDB Description: ferredoxin mutation s47a
PDB Compounds: (A:) ferredoxin

SCOPe Domain Sequences for d1qoga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qoga_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Anabaena sp., pcc 7119 and 7120 [TaxId: 1167]}
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacatcagklvsgtvdq
sdqsfldddqieagyvltcvayptsdvviqthkeedly

SCOPe Domain Coordinates for d1qoga_:

Click to download the PDB-style file with coordinates for d1qoga_.
(The format of our PDB-style files is described here.)

Timeline for d1qoga_: