Lineage for d1vcbg_ (1vcb G:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325381Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 325382Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 325383Family d.15.1.1: Ubiquitin-related [54237] (8 proteins)
  6. 325384Protein Elongin B [54246] (1 species)
  7. 325385Species Human (Homo sapiens) [TaxId:9606] [54247] (3 PDB entries)
  8. 325390Domain d1vcbg_: 1vcb G: [37605]
    Other proteins in same PDB: d1vcbb_, d1vcbc_, d1vcbe_, d1vcbf_, d1vcbh_, d1vcbi_, d1vcbk_, d1vcbl_

Details for d1vcbg_

PDB Entry: 1vcb (more details), 2.7 Å

PDB Description: the vhl-elonginc-elonginb structure

SCOP Domain Sequences for d1vcbg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vcbg_ d.15.1.1 (G:) Elongin B {Human (Homo sapiens)}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppe

SCOP Domain Coordinates for d1vcbg_:

Click to download the PDB-style file with coordinates for d1vcbg_.
(The format of our PDB-style files is described here.)

Timeline for d1vcbg_: