![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (6 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (8 proteins) |
![]() | Protein Elongin B [54246] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54247] (3 PDB entries) |
![]() | Domain d1vcbg_: 1vcb G: [37605] Other proteins in same PDB: d1vcbb_, d1vcbc_, d1vcbe_, d1vcbf_, d1vcbh_, d1vcbi_, d1vcbk_, d1vcbl_ |
PDB Entry: 1vcb (more details), 2.7 Å
SCOP Domain Sequences for d1vcbg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vcbg_ d.15.1.1 (G:) Elongin B {Human (Homo sapiens)} mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec gftsqtarpqapatvglafraddtfealciepfssppe
Timeline for d1vcbg_: