Lineage for d1vcbc_ (1vcb C:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 292233Fold b.3: Prealbumin-like [49451] (6 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 292330Superfamily b.3.3: VHL [49468] (1 family) (S)
  5. 292331Family b.3.3.1: VHL [49469] (1 protein)
  6. 292332Protein VHL [49470] (1 species)
  7. 292333Species Human (Homo sapiens) [TaxId:9606] [49471] (3 PDB entries)
  8. 292336Domain d1vcbc_: 1vcb C: [22535]
    Other proteins in same PDB: d1vcba_, d1vcbb_, d1vcbd_, d1vcbe_, d1vcbg_, d1vcbh_, d1vcbj_, d1vcbk_

Details for d1vcbc_

PDB Entry: 1vcb (more details), 2.7 Å

PDB Description: the vhl-elonginc-elonginb structure

SCOP Domain Sequences for d1vcbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vcbc_ b.3.3.1 (C:) VHL {Human (Homo sapiens)}
lrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrda
gthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldivr
slyedledhpnvqkdlerltqe

SCOP Domain Coordinates for d1vcbc_:

Click to download the PDB-style file with coordinates for d1vcbc_.
(The format of our PDB-style files is described here.)

Timeline for d1vcbc_: