SCOPe 2.08: Domain d6nkmb_: 6nkm B:

Lineage for d6nkmb_ (6nkm B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Penicillium fellutanum [TaxId:70095] [375693] (2 PDB entries)

8. Domain d6nkmb_: 6nkm B: [375705]
   automated match to d1g0nb_
   complexed with nap, zwp

Details for d6nkmb_

PDB Entry: 6nkm, 1.9 Å

PDB Description: structure of phqe d166n reductase/diels-alderase from penicillium fellutanum in complex with nadp+ and substrate

PDB Compounds: (B:) Short chain dehydrogenase

SCOPe Domain Sequences for d6nkmb_:

Sequence; same for both SEQRES and ATOM records:

>d6nkmb_ c.2.1.0 (B:) automated matches {Penicillium fellutanum [TaxId: 70095]}
tdqlhgsrvlviggtsgigfavcaaalghgaivtivgsnaqklkdsvarlkssfpstdpd
divavrcdlsnsdtveqdiekalqlaagnskinhivitaadmtapppledltvdsvqrpg
iirlvaplmvakhlpkymnkcpqssltltsgahclrpnpgwtvisgycgaveamsrglai
dlkplrvnvvapgavlteavkdilgdaydaavemaeakstvgqtgspesvaqayiylmkd
hyasgsvvstnggmllv

Timeline for d6nkmb_:

• d6nkmb_ first appeared in SCOPe 2.07