SCOP 1.59: Domain d1b63a1: 1b63 A:217-331

Lineage for d1b63a1 (1b63 A:217-331)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families)

5. Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (3 proteins)

6. Protein DNA mismatch repair protein MutL [54225] (1 species)

7. Species Escherichia coli [TaxId:562] [54226] (3 PDB entries)

8. Domain d1b63a1: 1b63 A:217-331 [37566]
   Other proteins in same PDB: d1b63a2

Details for d1b63a1

PDB Entry: 1b63, 1.9 Å

PDB Description: mutl complexed with adpnp

SCOP Domain Sequences for d1b63a1:

Sequence; same for both SEQRES and ATOM records:

>d1b63a1 d.14.1.3 (A:217-331) DNA mismatch repair protein MutL {Escherichia coli}
gtafleqalaiewqhgdltlrgwvadpnhttpalaeiqycyvngrmmrdrlinhairqac
edklgadqqpafvlyleidphqvdvnvhpakhevrfhqsrlvhdfiyqgvlsvlq

Timeline for d1b63a1:

• d1b63a1 first appeared (with stable ids) in SCOP 1.55
  
• d1b63a1 appears in SCOP 1.57
  
• d1b63a1 appears in SCOP 1.61
  
• d1b63a1 appears in the current release, SCOPe 2.08