Lineage for d5zzna_ (5zzn A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632594Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2632595Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2632596Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2632805Protein Photosystem Q(B) protein 1, PsbA1 [161053] (2 species)
  7. 2632806Species Thermosynechococcus elongatus [TaxId:146786] [161054] (3 PDB entries)
    Uniprot P0A445 10-344
  8. 2632807Domain d5zzna_: 5zzn A: [375273]
    Other proteins in same PDB: d5zznb_, d5zznc_, d5zznd_, d5zzne_, d5zznf_, d5zznh_, d5zznj_, d5zznk_, d5zznm_, d5zzno_, d5zznt_, d5zznu_, d5zznv_, d5zznx_, d5zznz_
    automated match to d2axta1
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, unl; mutant

Details for d5zzna_

PDB Entry: 5zzn (more details), 2.1 Å

PDB Description: crystal structure of photosystem ii from an sqdg-deficient mutant of thermosynechococcus elongatus
PDB Compounds: (A:) Photosystem II protein D1 1

SCOPe Domain Sequences for d5zzna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zzna_ f.26.1.1 (A:) Photosystem Q(B) protein 1, PsbA1 {Thermosynechococcus elongatus [TaxId: 146786]}
anlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsgs
llygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgrq
welsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqaeh
nilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetyniva
ahgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngfnfnhsvidak
gnvintwadiinranlgmevmhernahnfpldla

SCOPe Domain Coordinates for d5zzna_:

Click to download the PDB-style file with coordinates for d5zzna_.
(The format of our PDB-style files is described here.)

Timeline for d5zzna_: