Lineage for d6rzqb2 (6rzq B:221-414)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2885406Species Plasmodium falciparum [TaxId:36329] [225582] (23 PDB entries)
  8. 2885428Domain d6rzqb2: 6rzq B:221-414 [375231]
    automated match to d3fe1a2
    complexed with anp, gol, mg

Details for d6rzqb2

PDB Entry: 6rzq (more details), 1.81 Å

PDB Description: plasmodium falciparum hsp70-x chaperone nucleotide binding domain - anp-pnp bound state
PDB Compounds: (B:) Heat shock protein 70

SCOPe Domain Sequences for d6rzqb2:

Sequence, based on SEQRES records: (download)

>d6rzqb2 c.55.1.0 (B:221-414) automated matches {Plasmodium falciparum [TaxId: 36329]}
geqnilifdlgggtfdvslltledgifevkatsgdthlggedfdnklvnfcvqdfkkkng
gkdvsknskslrrlrtqcekakrvlsssaqatievdslfdgidynvnitrakfeelcmdq
frntlipvekvlkdakmdksqvheivlvggstripkiqqlikdffngkepckainpdeav
aygaavqaailsgd

Sequence, based on observed residues (ATOM records): (download)

>d6rzqb2 c.55.1.0 (B:221-414) automated matches {Plasmodium falciparum [TaxId: 36329]}
geqnilifdlgggtfdvslltledgifevkatsgdthlggedfdnklvnfcvqdfkkkng
kdvsknskslrrlrtqcekakrvlsssaqatievdslfdgidynvnitrakfeelcmdqf
rntlipvekvlkdakmdksqvheivlvggstripkiqqlikdffngkepckainpdeava
ygaavqaailsgd

SCOPe Domain Coordinates for d6rzqb2:

Click to download the PDB-style file with coordinates for d6rzqb2.
(The format of our PDB-style files is described here.)

Timeline for d6rzqb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6rzqb1