SCOPe 2.07: Domain d6mssa2: 6mss A:111-187

Lineage for d6mssa2 (6mss A:111-187)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d6mssa2: 6mss A:111-187 [375003]
   Other proteins in same PDB: d6mssa1, d6mssb1, d6mssb2, d6mssc1, d6mssc2, d6mssc3, d6mssd_
   automated match to d4eura2
   complexed with nag, srv

Details for d6mssa2

PDB Entry: 6mss, 3 Å

PDB Description: diversity in the type ii natural killer t cell receptor repertoire and antigen specificity leads to differing cd1d docking strategies

PDB Compounds: (A:) A11B8.2 NKT TCR alpha-chain

SCOPe Domain Sequences for d6mssa2:

Sequence, based on SEQRES records:

>d6mssa2 b.1.1.2 (A:111-187) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafn

Sequence, based on observed residues (ATOM records):

>d6mssa2 b.1.1.2 (A:111-187) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdsksksvclftdfdsqtnvsqssdvyitdkcvldmrsmdfksnsavaw
snksdfacanafn

Timeline for d6mssa2:

• d6mssa2 is new in SCOPe 2.07-stable
  
• d6mssa2 appears in the current release, SCOPe 2.08