Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
Domain d6mssa1: 6mss A:3-110 [375002] Other proteins in same PDB: d6mssa2, d6mssc1, d6mssc3, d6mssd_ automated match to d4eura1 complexed with nag, srv |
PDB Entry: 6mss (more details), 3 Å
SCOPe Domain Sequences for d6mssa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mssa1 b.1.1.0 (A:3-110) automated matches {Mouse (Mus musculus) [TaxId: 10090]} mpveqnppalslyegadsglrcnfsttmksvqwfqqnhrgrlitlfylaqgtkengrlks tfnskerystlhikdaqledsgtyfcaavnmgykltfgtgtsllvdpn
Timeline for d6mssa1: