Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) |
Family c.33.1.0: automated matches [191389] (1 protein) not a true family |
Protein automated matches [190499] (25 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [374982] (1 PDB entry) |
Domain d6kuaf_: 6kua F: [374985] automated match to d3s2sa_ complexed with zn |
PDB Entry: 6kua (more details), 2.1 Å
SCOPe Domain Sequences for d6kuaf_:
Sequence, based on SEQRES records: (download)
>d6kuaf_ c.33.1.0 (F:) automated matches {Staphylococcus aureus [TaxId: 1280]} mthrallvvdysydfiaddglltcgkpgqniedfivsrindfnyyqdhifflmdlhylhd ihhpesklfpphnivdtsgrelygkvgklyetikaqpnvhfidktrydsffgtpldsllr ersinqveivgvctdicvlhtaisaynlgykisvpaegvasfnqkghewalahfknslga eveq
>d6kuaf_ c.33.1.0 (F:) automated matches {Staphylococcus aureus [TaxId: 1280]} mthrallvvdysydfiaddtcgkpgqniedfivsrindfnyyqdhifflmdlhsgrelyg kvgklyetikaqpnvhfidktrydsffgtpldsllrersinqveivgvctdicvlhtais aynlgykisvpaegvasfnqkghewalahfknslgaeveq
Timeline for d6kuaf_: