Lineage for d6kuac_ (6kua C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2472415Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2472416Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2472469Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2472470Protein automated matches [190499] (25 species)
    not a true protein
  7. 2472585Species Staphylococcus aureus [TaxId:1280] [374982] (1 PDB entry)
  8. 2472588Domain d6kuac_: 6kua C: [374983]
    automated match to d3s2sa_
    complexed with zn

Details for d6kuac_

PDB Entry: 6kua (more details), 2.1 Å

PDB Description: crystal structure of the nicotinamidase sapnca from staphylococcus aureus
PDB Compounds: (C:) cysteine hydrolase

SCOPe Domain Sequences for d6kuac_:

Sequence, based on SEQRES records: (download)

>d6kuac_ c.33.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mthrallvvdysydfiaddglltcgkpgqniedfivsrindfnyyqdhifflmdlhylhd
ihhpesklfpphnivdtsgrelygkvgklyetikaqpnvhfidktrydsffgtpldsllr
ersinqveivgvctdicvlhtaisaynlgykisvpaegvasfnqkghewalahfknslga
eve

Sequence, based on observed residues (ATOM records): (download)

>d6kuac_ c.33.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mthrallvvdysydfiaddglltpgqniedfivsrindfnyyqdhifflmdlhelygkvg
klyetikaqpnvhfidktrydsffgtpldsllrersinqveivgvctdicvlhtaisayn
lgykisvpaegvasfnqkghewalahfknslgaeve

SCOPe Domain Coordinates for d6kuac_:

Click to download the PDB-style file with coordinates for d6kuac_.
(The format of our PDB-style files is described here.)

Timeline for d6kuac_: