Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.13: Chromo domain-like [54160] (4 families) SH3-like barrel is capped by a C-terminal helix |
Family b.34.13.2: Chromo domain [54165] (8 proteins) lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold |
Protein Heterochromatin protein 1, HP1 [54166] (4 species) duplication: consists of two homologous domains, N-terminal chromo domain and C-terminal chromo shadow domain |
Species Fission yeast (Schizosaccharomyces pombe), SWI6 [TaxId:4896] [54169] (1 PDB entry) |
Domain d1e0bb_: 1e0b B: [37477] C-terminal shadow chromo domain complexed with 1pg |
PDB Entry: 1e0b (more details), 1.9 Å
SCOPe Domain Sequences for d1e0bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e0bb_ b.34.13.2 (B:) Heterochromatin protein 1, HP1 {Fission yeast (Schizosaccharomyces pombe), SWI6 [TaxId: 4896]} ydswedlvssidtierkddgtleiyltwkngaishhpstitnkkcpqkmlqfyeshltf
Timeline for d1e0bb_: