SCOPe 2.07: Domain d6puab1: 6pua B:1-209

Lineage for d6puab1 (6pua B:1-209)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.3: Galactoside acetyltransferase-like [51168] (4 proteins)
   this is a repeat family; one repeat unit is 1kqa A:80-100 found in domain

6. Protein automated matches [190704] (6 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [188603] (4 PDB entries)

8. Domain d6puab1: 6pua B:1-209 [374672]
   Other proteins in same PDB: d6puaa2, d6puab2, d6puac2
   automated match to d3eevc_
   complexed with cl, edo, mpd, po4

Details for d6puab1

PDB Entry: 6pua, 2 Å

PDB Description: the 2.0 a crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae

PDB Compounds: (B:) Chloramphenicol acetyltransferase

SCOPe Domain Sequences for d6puab1:

Sequence; same for both SEQRES and ATOM records:

>d6puab1 b.81.1.3 (B:1-209) automated matches {Vibrio cholerae [TaxId: 243277]}
mnfftspfsgipldqqvtnpniivgkhsyysgyyhghsfddcvrylhperddvdklvigs
fcsigsgavfmmagnqghrsdwistfpffyqdndnfadardgftrsgdtiighdvwigte
amimpgvkighgaiiasrsvvtkdvapyevvgsnpakhikfrfsdveiamllemawwnwp
eswlkesmqslcssdieglylnwqskart

Timeline for d6puab1:

• d6puab1 is new in SCOPe 2.07-stable
  
• d6puab1 appears in the current release, SCOPe 2.08