Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) |
Protein automated matches [190161] (30 species) not a true protein |
Species Escherichia coli [TaxId:562] [187306] (106 PDB entries) |
Domain d6skqb_: 6skq B: [374495] automated match to d2rl3b_ complexed with mer, so4 |
PDB Entry: 6skq (more details), 2.1 Å
SCOPe Domain Sequences for d6skqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6skqb_ e.3.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]} sitenmswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiiglet gviknehqvfkwdgkpramkqwerdltlrgaiqvsalpvfqqiarevgevrmqkylkkfs ygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapey lvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimes egiig
Timeline for d6skqb_: