SCOPe 2.07: Domain d6phza1: 6phz A:1-342

Lineage for d6phza1 (6phz A:1-342)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.0: automated matches [191615] (1 protein)
   not a true family

6. Protein automated matches [191124] (8 species)
   not a true protein

7. Species Marinobacter subterrani [TaxId:1658765] [374296] (8 PDB entries)

8. Domain d6phza1: 6phz A:1-342 [374442]
   Other proteins in same PDB: d6phza2, d6phzb2
   automated match to d4zura_
   complexed with fks, k, mg, zn

Details for d6phza1

PDB Entry: 6phz, 2 Å

PDB Description: crystal structure of marinobacter subterrani acetylpolyamine amidohydrolase (msapah) complexed with 7-[(3-aminopropyl)amino]-1,1, 1-trifluoroheptan-2-one

PDB Compounds: (A:) Acetylpolyamine amidohydrolase

SCOPe Domain Sequences for d6phza1:

Sequence; same for both SEQRES and ATOM records:

>d6phza1 d.165.1.0 (A:1-342) automated matches {Marinobacter subterrani [TaxId: 1658765]}
mktvfsplhsrrhvkteldgglliephekpsraetilarvkdqalgeilepeefglgpvk
rvhtadyvsfletcwdewvaagkrgeaiptfwvgrgmrarlpkdidgrlgyyslgadtsi
sdgtweaarasanvaltaqklvaegeraafalcrppghhahadvfggycffnnaaiaaqa
frdqgygkvavldvdfhhgngtqaifydrsdvltislhgdpdlvfphflgfedetgegdg
eaynlnivfppdtpfsiwsqglekacerirtfapdalvvalgvdtfeedpisffkltsgd
ylklgkrleqlglptvftmeggydvdaigvnavnvmqgfegk

Timeline for d6phza1:

• d6phza1 is new in SCOPe 2.07-stable
  
• d6phza1 appears in the current release, SCOPe 2.08