SCOPe 2.07: Domain d6pica1: 6pic A:1-342

Lineage for d6pica1 (6pic A:1-342)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.0: automated matches [191615] (1 protein)
   not a true family

6. Protein automated matches [191124] (8 species)
   not a true protein

7. Species Marinobacter subterrani [TaxId:1658765] [374296] (8 PDB entries)

8. Domain d6pica1: 6pic A:1-342 [374312]
   Other proteins in same PDB: d6pica2, d6picb2, d6picc2, d6picd2, d6pice2, d6picf2, d6picg2, d6pich2
   automated match to d4zura_
   complexed with 6xa, k, mg, zn

Details for d6pica1

PDB Entry: 6pic, 2.03 Å

PDB Description: crystal structure of marinobacter subterrani acetylpolyamine amidohydrolase (msapah) complexed with 6-amino-n-hydroxyhexanamide

PDB Compounds: (A:) Acetylpolyamine amidohydrolase

SCOPe Domain Sequences for d6pica1:

Sequence; same for both SEQRES and ATOM records:

>d6pica1 d.165.1.0 (A:1-342) automated matches {Marinobacter subterrani [TaxId: 1658765]}
mktvfsplhsrrhvkteldgglliephekpsraetilarvkdqalgeilepeefglgpvk
rvhtadyvsfletcwdewvaagkrgeaiptfwvgrgmrarlpkdidgrlgyyslgadtsi
sdgtweaarasanvaltaqklvaegeraafalcrppghhahadvfggycffnnaaiaaqa
frdqgygkvavldvdfhhgngtqaifydrsdvltislhgdpdlvfphflgfedetgegdg
eaynlnivfppdtpfsiwsqglekacerirtfapdalvvalgvdtfeedpisffkltsgd
ylklgkrleqlglptvftmeggydvdaigvnavnvmqgfegk

Timeline for d6pica1:

• d6pica1 is new in SCOPe 2.07-stable
  
• d6pica1 appears in the current release, SCOPe 2.08