| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
| Protein automated matches [227126] (21 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [324640] (4 PDB entries) |
| Domain d6rjcb2: 6rjc B:333-527 [374036] Other proteins in same PDB: d6rjca1, d6rjca3, d6rjca4, d6rjcb1, d6rjcb3, d6rjcb4 automated match to d1qgda1 complexed with ca, edo, gol, na |
PDB Entry: 6rjc (more details), 1.05 Å
SCOPe Domain Sequences for d6rjcb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rjcb2 c.36.1.0 (B:333-527) automated matches {Escherichia coli [TaxId: 83333]}
mpsdfdakakefiaklqanpakiasrkasqnaieafgpllpeflggsadlapsnltlwsg
skainedaagnyihygvrefgmtaiangislhggflpytstflmfveyarnavrmaalmk
qrqvmvythdsiglgedgpthqpveqvaslrvtpnmstwrpcdqvesavawkygverqdg
ptalilsrqnlaqqe
Timeline for d6rjcb2:
View in 3DDomains from other chains: (mouse over for more information) d6rjca1, d6rjca2, d6rjca3, d6rjca4 |