Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) |
Family c.48.1.0: automated matches [227237] (1 protein) not a true family |
Protein automated matches [226991] (9 species) not a true protein |
Species Escherichia coli [TaxId:83333] [324642] (4 PDB entries) |
Domain d6rjcb3: 6rjc B:528-663 [374037] Other proteins in same PDB: d6rjca1, d6rjca2, d6rjca4, d6rjcb1, d6rjcb2, d6rjcb4 automated match to d2r8oa3 complexed with ca, edo, gol, na |
PDB Entry: 6rjc (more details), 1.05 Å
SCOPe Domain Sequences for d6rjcb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rjcb3 c.48.1.0 (B:528-663) automated matches {Escherichia coli [TaxId: 83333]} rteeqlaniarggyvlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstd afdkqdaayresvlpkavtarvaveagiadywykyvglngaivgmttfgesapaellfee fgftvdnvvakakell
Timeline for d6rjcb3:
View in 3D Domains from other chains: (mouse over for more information) d6rjca1, d6rjca2, d6rjca3, d6rjca4 |