Lineage for d6rjcb3 (6rjc B:528-663)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2488514Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 2488515Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 2488687Family c.48.1.0: automated matches [227237] (1 protein)
    not a true family
  6. 2488688Protein automated matches [226991] (9 species)
    not a true protein
  7. 2488709Species Escherichia coli [TaxId:83333] [324642] (4 PDB entries)
  8. 2488715Domain d6rjcb3: 6rjc B:528-663 [374037]
    Other proteins in same PDB: d6rjca1, d6rjca2, d6rjca4, d6rjcb1, d6rjcb2, d6rjcb4
    automated match to d2r8oa3
    complexed with ca, edo, gol, na

Details for d6rjcb3

PDB Entry: 6rjc (more details), 1.05 Å

PDB Description: e.coli transketolase apoenzyme
PDB Compounds: (B:) Transketolase 1

SCOPe Domain Sequences for d6rjcb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rjcb3 c.48.1.0 (B:528-663) automated matches {Escherichia coli [TaxId: 83333]}
rteeqlaniarggyvlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstd
afdkqdaayresvlpkavtarvaveagiadywykyvglngaivgmttfgesapaellfee
fgftvdnvvakakell

SCOPe Domain Coordinates for d6rjcb3:

Click to download the PDB-style file with coordinates for d6rjcb3.
(The format of our PDB-style files is described here.)

Timeline for d6rjcb3: