Lineage for d6ai5c_ (6ai5 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2699500Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2699501Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
    automatically mapped to Pfam PF07361
  6. 2699739Protein automated matches [190502] (2 species)
    not a true protein
  7. 2699740Species Escherichia coli [TaxId:562] [187450] (15 PDB entries)
  8. 2699754Domain d6ai5c_: 6ai5 C: [373991]
    automated match to d4u9da_
    complexed with cl, hem, mg, zn

Details for d6ai5c_

PDB Entry: 6ai5 (more details), 1.81 Å

PDB Description: disulfide-free, zn-directed tetramer of the engineered cyt cb562 variant, c96t/a104ab3
PDB Compounds: (C:) Soluble cytochrome b562

SCOPe Domain Sequences for d6ai5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ai5c_ a.24.3.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
frhgfwiligqihdalhlanegkvkeaqhaaeqlkttcnhchqayr

SCOPe Domain Coordinates for d6ai5c_:

Click to download the PDB-style file with coordinates for d6ai5c_.
(The format of our PDB-style files is described here.)

Timeline for d6ai5c_: