Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species) contains an extension to the common fold at the N-terminus |
Species Human (Homo sapiens) [TaxId:9606] [311422] (14 PDB entries) |
Domain d6e5bd_: 6e5b D: [373953] Other proteins in same PDB: d6e5ba_, d6e5bb_, d6e5bf_, d6e5bh_, d6e5bi_, d6e5bj_, d6e5bk_, d6e5bl_, d6e5bm_, d6e5bn_, d6e5bt_, d6e5bv_, d6e5bw_, d6e5bx_, d6e5by_, d6e5bz_ automated match to d6reye_ complexed with huj, na, scn |
PDB Entry: 6e5b (more details), 2.77 Å
SCOPe Domain Sequences for d6e5bd_:
Sequence, based on SEQRES records: (download)
>d6e5bd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Human (Homo sapiens) [TaxId: 9606]} drgvntfspegrlfqveyaieaiklgstaigiqtsegvclavekritsplmepssiekiv eidahigcamsgliadaktlidkarvetqnhwftynetmtvesvtqavsnlalqfgeeda dpgamsrpfgvallfggvdekgpqlfhmdpsgtfvqcdaraigsasegaqsslqevyhks mtlkeaikssliilkqvmeeklnatnielatvqpgqnfhmftkeeleevikd
>d6e5bd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Human (Homo sapiens) [TaxId: 9606]} drgvntfspegrlfqveyaieaiklgstaigiqtsegvclavekritsplmepssiekiv eidahigcamsgliadaktlidkarvetqnhwftynetmtvesvtqavsnlalqfgeeda damsrpfgvallfggvdekgpqlfhmdpsgtfvqcdaraigsasegaqsslqevyhksmt lkeaikssliilkqvmeeklnatnielatvqpgqnfhmftkeeleevikd
Timeline for d6e5bd_: