Lineage for d6e5bd_ (6e5b D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2594884Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2596997Species Human (Homo sapiens) [TaxId:9606] [311422] (14 PDB entries)
  8. 2597088Domain d6e5bd_: 6e5b D: [373953]
    Other proteins in same PDB: d6e5ba_, d6e5bb_, d6e5bf_, d6e5bh_, d6e5bi_, d6e5bj_, d6e5bk_, d6e5bl_, d6e5bm_, d6e5bn_, d6e5bt_, d6e5bv_, d6e5bw_, d6e5bx_, d6e5by_, d6e5bz_
    automated match to d6reye_
    complexed with huj, na, scn

Details for d6e5bd_

PDB Entry: 6e5b (more details), 2.77 Å

PDB Description: human immunoproteasome 20s particle in complex with compound 1
PDB Compounds: (D:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d6e5bd_:

Sequence, based on SEQRES records: (download)

>d6e5bd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Human (Homo sapiens) [TaxId: 9606]}
drgvntfspegrlfqveyaieaiklgstaigiqtsegvclavekritsplmepssiekiv
eidahigcamsgliadaktlidkarvetqnhwftynetmtvesvtqavsnlalqfgeeda
dpgamsrpfgvallfggvdekgpqlfhmdpsgtfvqcdaraigsasegaqsslqevyhks
mtlkeaikssliilkqvmeeklnatnielatvqpgqnfhmftkeeleevikd

Sequence, based on observed residues (ATOM records): (download)

>d6e5bd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Human (Homo sapiens) [TaxId: 9606]}
drgvntfspegrlfqveyaieaiklgstaigiqtsegvclavekritsplmepssiekiv
eidahigcamsgliadaktlidkarvetqnhwftynetmtvesvtqavsnlalqfgeeda
damsrpfgvallfggvdekgpqlfhmdpsgtfvqcdaraigsasegaqsslqevyhksmt
lkeaikssliilkqvmeeklnatnielatvqpgqnfhmftkeeleevikd

SCOPe Domain Coordinates for d6e5bd_:

Click to download the PDB-style file with coordinates for d6e5bd_.
(The format of our PDB-style files is described here.)

Timeline for d6e5bd_: