Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [311424] (11 PDB entries) |
Domain d6e5bb_: 6e5b b: [373918] Other proteins in same PDB: d6e5bc_, d6e5bd_, d6e5be_, d6e5bf_, d6e5bg_, d6e5bj_, d6e5bl_, d6e5bo_, d6e5bp_, d6e5bq_, d6e5br_, d6e5bs_, d6e5bt_, d6e5bu_, d6e5bx_, d6e5bz_ automated match to d4cr21_ complexed with huj, na, scn |
PDB Entry: 6e5b (more details), 2.77 Å
SCOPe Domain Sequences for d6e5bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6e5bb_ d.153.1.0 (b:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ttimavefdggvvmgsdsrvsageavvnrvfdklsplheriycalsgsaadaqavadmaa yqlelhgieleepplvlaaanvvrnisykyredlsahlmvagwdqreggqvygtlggmlt rqpfaiggsgstfiygyvdaaykpgmspeecrrfttdaialamsrdgssggviylvtita agvdhrvilgnelpkfyde
Timeline for d6e5bb_: