Lineage for d6e5bb_ (6e5b b:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2602131Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2602132Protein automated matches [190509] (19 species)
    not a true protein
  7. 2602601Species Human (Homo sapiens) [TaxId:9606] [311424] (11 PDB entries)
  8. 2602660Domain d6e5bb_: 6e5b b: [373918]
    Other proteins in same PDB: d6e5bc_, d6e5bd_, d6e5be_, d6e5bf_, d6e5bg_, d6e5bj_, d6e5bl_, d6e5bo_, d6e5bp_, d6e5bq_, d6e5br_, d6e5bs_, d6e5bt_, d6e5bu_, d6e5bx_, d6e5bz_
    automated match to d4cr21_
    complexed with huj, na, scn

Details for d6e5bb_

PDB Entry: 6e5b (more details), 2.77 Å

PDB Description: human immunoproteasome 20s particle in complex with compound 1
PDB Compounds: (b:) Proteasome subunit beta type-9

SCOPe Domain Sequences for d6e5bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e5bb_ d.153.1.0 (b:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ttimavefdggvvmgsdsrvsageavvnrvfdklsplheriycalsgsaadaqavadmaa
yqlelhgieleepplvlaaanvvrnisykyredlsahlmvagwdqreggqvygtlggmlt
rqpfaiggsgstfiygyvdaaykpgmspeecrrfttdaialamsrdgssggviylvtita
agvdhrvilgnelpkfyde

SCOPe Domain Coordinates for d6e5bb_:

Click to download the PDB-style file with coordinates for d6e5bb_.
(The format of our PDB-style files is described here.)

Timeline for d6e5bb_: