Lineage for d1pfmb_ (1pfm B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2175338Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2175339Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2175340Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2175517Protein Platelet factor 4, PF4 [54121] (2 species)
  7. 2175523Species Human (Homo sapiens) [TaxId:9606] [54123] (6 PDB entries)
  8. 2175545Domain d1pfmb_: 1pfm B: [37386]
    PF4-M2 chimeric mutant
    mutant

Details for d1pfmb_

PDB Entry: 1pfm (more details)

PDB Description: pf4-m2 chimeric mutant with the first 10 n-terminal residues of r-pf4 replaced by the n-terminal residues of the il8 sequence. models 1-15 of a 27-model set.
PDB Compounds: (B:) pf4-m2 chimera

SCOPe Domain Sequences for d1pfmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pfmb_ d.9.1.1 (B:) Platelet factor 4, PF4 {Human (Homo sapiens) [TaxId: 9606]}
msakelrcqcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqaplykk
iikklles

SCOPe Domain Coordinates for d1pfmb_:

Click to download the PDB-style file with coordinates for d1pfmb_.
(The format of our PDB-style files is described here.)

Timeline for d1pfmb_: