Lineage for d6maqb_ (6maq B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377239Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2377642Family b.2.3.0: automated matches [191391] (1 protein)
    not a true family
  6. 2377643Protein automated matches [190503] (10 species)
    not a true protein
  7. 2377649Species Escherichia coli [TaxId:364106] [349115] (10 PDB entries)
  8. 2377655Domain d6maqb_: 6maq B: [373650]
    automated match to d4xocb_
    complexed with gol, jcd

Details for d6maqb_

PDB Entry: 6maq (more details), 1.31 Å

PDB Description: f9 pilus adhesin fmlh lectin domain from e. coli uti89 in complex with galactoside 2'-{[(2s,3r,4r,5r,6r)-3-acetamido-4,5-dihydroxy-6- (hydroxymethyl)oxan-2-yl]oxy}-5-nitro-[1,1'-biphenyl]-3-carboxylic acid
PDB Compounds: (B:) Fimbrial adhesin FmlD

SCOPe Domain Sequences for d6maqb_:

Sequence, based on SEQRES records: (download)

>d6maqb_ b.2.3.0 (B:) automated matches {Escherichia coli [TaxId: 364106]}
fscnvdggssigagttsvyvnldpviqpgqnlvvdlsqhiscwndyggwydtdhinlvqg
safagslqsykgslywnnvtypfplttntnvldigdktpmplplklyitpvgaaggvvik
ageviarihmykiatlgsgnprnftwniisnnsvvm

Sequence, based on observed residues (ATOM records): (download)

>d6maqb_ b.2.3.0 (B:) automated matches {Escherichia coli [TaxId: 364106]}
fscnvdggssigagttsvyvnldpviqpgqnlvvdlsqhiscwndyggwydtdhinlvqg
safagslqsykgslywnnvtypfplttntnvldigdktpmplplklyitpvgvvikagev
iarihmykiatlgsgnprnftwniisnnsvvm

SCOPe Domain Coordinates for d6maqb_:

Click to download the PDB-style file with coordinates for d6maqb_.
(The format of our PDB-style files is described here.)

Timeline for d6maqb_: